PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02029g01003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 743aa    MW: 82665.8 Da    PI: 6.9186
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02029g01003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-095205571954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Niben101Scf02029g01003.1 520 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 557
                               664459******************************88 PP

2BELL121.73.1e-39380451172
                      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               +r e+q++k+kLls+ +eVdkrY++y+eq+q+v++sF+ v+g g+a+pYt+lA+ka+SrhF+cLkdaia q+
  Niben101Scf02029g01003.1 380 DRIEHQRRKVKLLSMFDEVDKRYNHYCEQMQMVVNSFDLVMGFGAAAPYTALAQKAMSRHFKCLKDAIAAQL 451
                               589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-71304449IPR006563POX domain
PfamPF075261.1E-51311448IPR006563POX domain
PROSITE profilePS5007112.487498561IPR001356Homeobox domain
CDDcd000862.79E-12501562No hitNo description
SMARTSM003894.0E-9501565IPR001356Homeobox domain
SuperFamilySSF466896.84E-17503567IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-28504567IPR009057Homeodomain-like
PfamPF059203.7E-18518557IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MVTHFNKFKA AHNPIQLPEK SNSLDNSMSQ DYHHQGLFSF SSAVERPQDE QQQQHITHQI  60
RQEKLRVDGL NPPPPLVAIE EEQSSGLQVY GTAGMLSEMF NFPPGITTAT ATELLQNQLT  120
QCYRNPNQRP QQQQPPTTNL GSEWFSNRQG MVPSESIDNT KVWNDRDSIT ALYQRQHNHI  180
SSIHTVESAS AMNLFSMNPQ PRSPSPSSAH PTTTLQGVPN AIGGHFSQFI CGGATGNHFN  240
TPNDIGGVNI MQGLSLSLSS SLQHLEAAKV EDQLRMSGGE MLFFNQGAGQ NHHHQIHVGF  300
GSSQGLVNVW RNSKYANAAQ ELLDEFCSVG RSQLFKKNKV SRNNNTKTSS NPNSNNPSGN  360
NNNNKNNNSS KDLSPLSVAD RIEHQRRKVK LLSMFDEVDK RYNHYCEQMQ MVVNSFDLVM  420
GFGAAAPYTA LAQKAMSRHF KCLKDAIAAQ LKHSCELLGE KDATTSGLTK GETPRLKLIE  480
KSLRQQQRAI QQMGMMDAEA WRPQRGLPER SVTILRAWLF EHFLHPYPSD ADKHLLARQT  540
GLSRNQVSNW FINARVRLWK PMVEDMYQKE AKEEEEEDDE NMEKSQNQNS SNNIAQTPTP  600
NSSTNTITTG SGTETKTAAT VRAATILSVA SDKRSEINVP ENDSSIVAMN RLCFSENHTE  660
HHESSSRATH EMAHHSFPAI QDSDGMSRRE AVSGVEYGTT NIMDISDNGT RMIRFGTTAA  720
GDVSLTLGLH HAGDLPENTH LFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15507564562Homeobox protein Meis2
3k2a_B2e-15507564562Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009769608.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-143BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLQ8LLE00.0Q8LLE0_SOLTU; BEL1-related homeotic protein 22 (Fragment)
STRINGPOPTR_0007s12170.10.0(Populus trichocarpa)
STRINGPGSC0003DMT4000261720.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-122BEL1-like homeodomain 2